High-Performance Open-Source Archive
The protr package offers a unique and comprehensive toolkit for generating various numerical representation schemes of protein sequences. The descriptors included are extensively utilized in bioinformatics and chemogenomics research.
The commonly used descriptors listed in protr include amino acid composition, autocorrelation, CTD, conjoint traid, quasi-sequence order, pseudo amino acid composition, and profile-based descriptors derived by Position-Specific Scoring Matrix (PSSM).
The descriptors for proteochemometric (PCM) modeling include the scales-based descriptors derived by principal components analysis, factor analysis, multidimensional scaling, amino acid properties (AAindex), 20+ classes of 2D and 3D molecular descriptors (for example, Topological, WHIM, VHSE, among others), and BLOSUM/PAM matrix-derived descriptors.
The protr package also implemented parallelized similarity computation derived by pairwise protein sequence alignment and Gene Ontology (GO) semantic similarity measures. ProtrWeb, the web application built on protr, can be accessed from http://protr.org.
If you find protr useful in your research, please feel free to cite our paper:
Nan Xiao, Dong-Sheng Cao, Min-Feng Zhu, and Qing-Song Xu. (2015). protr/ProtrWeb: R package and web server for generating various numerical representation schemes of protein sequences. Bioinformatics 31 (11), 1857-1859.
BibTeX entry:
@article{Xiao2015,
author = {Xiao, Nan and Cao, Dong-Sheng and Zhu, Min-Feng and Xu, Qing-Song.},
title = {protr/{ProtrWeb}: {R} package and web server for generating various numerical representation schemes of protein sequences},
journal = {Bioinformatics},
year = {2015},
volume = {31},
number = {11},
pages = {1857--1859},
doi = {10.1093/bioinformatics/btv042}
}
Here, we use the subcellular localization dataset of human proteins presented in Chou and Shen (2008) to demonstrate the basic usage of protr.
The complete dataset includes 3,134 protein sequences (2,750 different proteins) classified into 14 human subcellular locations. We selected two classes of proteins as our benchmark dataset. Class 1 contains 325 extracell proteins and class 2 includes 307 mitochondrion proteins. We aim to build a random forest classification model to classify these two types of proteins.
First, we load the protr package, then read the protein sequences
stored in two separated FASTA files with readFASTA():
library("protr")
# Load FASTA files
# Note that `system.file()` is for accessing example files
# in the protr package. Replace it with your own file path.
extracell <- readFASTA(
system.file(
"protseq/extracell.fasta",
package = "protr"
)
)
mitonchon <- readFASTA(
system.file(
"protseq/mitochondrion.fasta",
package = "protr"
)
)
To read protein sequences stored in PDB format files, use
readPDB() instead. The loaded sequences will be stored as
two lists in R, and each component is a character string representing
one protein sequence. In this case, there are 325 extracell
protein sequences and 306 mitonchon protein sequences:
length(extracell)
## [1] 325
length(mitonchon)
## [1] 306
To ensure that the protein sequences only have the 20 standard amino
acid types, which is usually required for the descriptor computation, we
use the protcheck() function to do the amino acid type
sanity check and remove the non-standard sequences:
extracell <- extracell[(sapply(extracell, protcheck))]
mitonchon <- mitonchon[(sapply(mitonchon, protcheck))]
length(extracell)
## [1] 323
length(mitonchon)
## [1] 304
Two protein sequences were removed from each class. For the remaining sequences, we calculate the Type II PseAAC descriptor, i.e., the amphiphilic pseudo amino acid composition (APseAAC) descriptor (Chou 2005) and make class labels for classification modeling.
# Calculate APseAAC descriptors
x1 <- t(sapply(extracell, extractAPAAC))
x2 <- t(sapply(mitonchon, extractAPAAC))
x <- rbind(x1, x2)
# Make class labels
labels <- as.factor(c(rep(0, length(extracell)), rep(1, length(mitonchon))))
In protr, the functions of commonly used descriptors for protein
sequences and proteochemometric (PCM) modeling descriptors are named
after extract...().
Next, we will split the data into a 75% training set and a 25% test set.
set.seed(1001)
# Split training and test set
tr.idx <- c(
sample(1:nrow(x1), round(nrow(x1) * 0.75)),
sample(nrow(x1) + 1:nrow(x2), round(nrow(x2) * 0.75))
)
te.idx <- setdiff(1:nrow(x), tr.idx)
x.tr <- x[tr.idx, ]
x.te <- x[te.idx, ]
y.tr <- labels[tr.idx]
y.te <- labels[te.idx]
We will train a random forest classification model on the training
set with 5-fold cross-validation, using the randomForest
package.
library("randomForest")
rf.fit <- randomForest(x.tr, y.tr, cv.fold = 5)
rf.fit
The training result is:
## Call:
## randomForest(x = x.tr, y = y.tr, cv.fold = 5)
## Type of random forest: classification
## Number of trees: 500
## No. of variables tried at each split: 8
##
## OOB estimate of error rate: 25.11%
## Confusion matrix:
## 0 1 class.error
## 0 196 46 0.1900826
## 1 72 156 0.3157895
With the model trained on the training set, we predict on the test
set and plot the ROC curve with the pROC package, as is
shown in Figure 1.
# Predict on test set
rf.pred <- predict(rf.fit, newdata = x.te, type = "prob")[, 1]
# Plot ROC curve
library("pROC")
plot.roc(y.te, rf.pred, grid = TRUE, print.auc = TRUE)
The area under the ROC curve (AUC) is:
## Call:
## plot.roc.default(x = y.te, predictor = rf.pred, col = "#0080ff",
## grid = TRUE, print.auc = TRUE)
##
## Data: rf.pred in 81 controls (y.te 0) > 76 cases (y.te 1).
## Area under the curve: 0.8697
Figure 1: ROC curve for the test set of protein subcellular localization data.
The protr package (Xiao et al. 2015)
implemented most of the state-of-the-art protein sequence descriptors
with R. Generally, each type of the descriptor (feature) can be
calculated with a function named extractX() in the protr
package, where X stands for the abbreviation of the
descriptor name. The descriptors are:
extractAAC() - Amino acid compositionextractDC() - Dipeptide compositionextractTC() - Tripeptide compositionextractMoreauBroto() - Normalized Moreau-Broto
autocorrelationextractMoran() - Moran autocorrelationextractGeary() - Geary autocorrelationextractCTDC() - CompositionextractCTDT() - TransitionextractCTDD() - DistributionextractCTriad() - Conjoint triad descriptorsextractSOCN() - Sequence-order-coupling numberextractQSO() - Quasi-sequence-order descriptorsextractPAAC() - Pseudo-amino acid composition
(PseAAC)extractAPAAC() - Amphiphilic pseudo-amino acid
composition (APseAAC)extractPSSM()extractPSSMAcc()extractPSSMFeature()The descriptors commonly used in Proteochemometric Modeling (PCM) implemented in protr include:
extractScales(), extractScalesGap() -
Scales-based descriptors derived by Principal Components Analysis
extractProtFP(), extractProtFPGap() -
Scales-based descriptors derived by amino acid properties from AAindex
(a.k.a. Protein Fingerprint)extractDescScales() - Scales-based descriptors derived
by 20+ classes of 2D and 3D molecular descriptors (Topological, WHIM,
VHSE, etc.)extractFAScales() - Scales-based descriptors derived by
Factor AnalysisextractMDSScales() - Scales-based descriptors derived
by Multidimensional ScalingextractBLOSUM() - BLOSUM and PAM matrix-derived
descriptorsThe protr package integrates the function of parallelized similarity score computation derived by local or global protein sequence alignment between a list of protein sequences; Biostrings and pwalign provide the sequence alignment computation, and the corresponding functions listed in the protr package include:
twoSeqSim() - Similarity calculation derived by
sequence alignment between two protein sequencesparSeqSim() - Parallelized pairwise similarity
calculation with a list of protein sequences (in-memory version)parSeqSimDisk() - Parallelized pairwise similarity
calculation with a list of protein sequences (disk-based version)crossSetSim() - Parallelized pairwise similarity
calculation between two sets of protein sequences (in-memory
version)protr also integrates the function for parallelized similarity score computation derived by Gene Ontology (GO) semantic similarity measures between a list of GO terms / Entrez Gene IDs, the GO similarity computation is provided by GOSemSim, the corresponding functions listed in the protr package include:
twoGOSim() - Similarity calculation derived by GO-terms
semantic similarity measures between two GO terms / Entrez Gene
IDs;parGOSim() - Pairwise similarity calculation with a
list of GO terms / Entrez Gene IDs.To use the parSeqSim() function, we suggest the users to
install the packages foreach and doParallel first in order to make the
parallelized pairwise similarity computation available.
In the following sections, we will introduce the descriptors and function usage in this order.
Note: Users need to evaluate the underlying details of the descriptors provided intelligently, instead of using protr with their data blindly, especially for the descriptor types that have more flexibility. It would be wise for the users to use some negative and positive control comparisons where relevant to help guide the interpretation of the results.
A protein or peptide sequence with \(N\) amino acid residues can be generally represented as \(\{\,R_1, R_2, \ldots, R_n\,\}\), where \(R_i\) represents the residue at the \(i\)-th position in the sequence. The labels \(i\) and \(j\) are used to index amino acid position in a sequence, and \(r\), \(s\), \(t\) are used to represent the amino acid type. The computed descriptors are roughly categorized into 4 groups according to their major applications.
A protein sequence can be partitioned equally into segments. The descriptors designed for the complete sequence can often be applied to each individual segment.
The amino acid composition describes the fraction of each amino acid type within a protein sequence. The fractions of all 20 natural amino acids are calculated as follows:
\[ f(r) = \frac{N_r}{N} \quad r = 1, 2, \ldots, 20. \]
where \(N_r\) is the number of the amino acid type \(r\) and \(N\) is the length of the sequence.
As was described above, we can use the function
extractAAC() to extract the descriptors (features) from
protein sequences:
library("protr")
x <- readFASTA(system.file(
"protseq/P00750.fasta",
package = "protr"
))[[1]]
extractAAC(x)
#> A R N D C E Q
#> 0.06405694 0.07117438 0.03914591 0.05160142 0.06761566 0.04804270 0.04804270
#> G H I L K M F
#> 0.08185053 0.03024911 0.03558719 0.07651246 0.03914591 0.01245552 0.03202847
#> P S T W Y V
#> 0.05338078 0.08896797 0.04448399 0.02313167 0.04270463 0.04982206
Here, using the function readFASTA(), we loaded a single
protein sequence (P00750, Tissue-type plasminogen activator) from a
FASTA format file. Then, we extracted the AAC descriptors with
extractAAC(). The result returned is a named vector whose
elements are tagged with the name of each amino acid.
Dipeptide composition gives a 400-dimensional descriptor, defined as:
\[ f(r, s) = \frac{N_{rs}}{N - 1} \quad r, s = 1, 2, \ldots, 20. \]
where \(N_{rs}\) is the number of
dipeptides represented by amino acid type \(r\) and type \(s\). Similar to extractAAC(),
we use extractDC() to compute the descriptors:
dc <- extractDC(x)
head(dc, n = 30L)
#> AA RA NA DA CA EA
#> 0.003565062 0.003565062 0.000000000 0.007130125 0.003565062 0.003565062
#> QA GA HA IA LA KA
#> 0.007130125 0.007130125 0.001782531 0.003565062 0.001782531 0.001782531
#> MA FA PA SA TA WA
#> 0.000000000 0.005347594 0.003565062 0.007130125 0.003565062 0.000000000
#> YA VA AR RR NR DR
#> 0.000000000 0.000000000 0.003565062 0.007130125 0.005347594 0.001782531
#> CR ER QR GR HR IR
#> 0.005347594 0.005347594 0.000000000 0.007130125 0.001782531 0.003565062
Here, we only showed the first 30 elements of the result vector and omitted the rest of the result. The element names of the returned vector are self-explanatory, as before.
Tripeptide composition gives an 8000-dimensional descriptor, defined as:
\[ f(r, s, t) = \frac{N_{rst}}{N - 2} \quad r, s, t = 1, 2, \ldots, 20 \]
where \(N_{rst}\) is the number of
tripeptides represented by amino acid type \(r\), \(s\), and \(t\). With the function
extractTC(), we can easily obtain the length-8000
descriptor, to save some space, here we also omitted the long
outputs:
tc <- extractTC(x)
head(tc, n = 36L)
#> AAA RAA NAA DAA CAA EAA
#> 0.000000000 0.000000000 0.000000000 0.000000000 0.000000000 0.000000000
#> QAA GAA HAA IAA LAA KAA
#> 0.001785714 0.000000000 0.000000000 0.000000000 0.000000000 0.000000000
#> MAA FAA PAA SAA TAA WAA
#> 0.000000000 0.000000000 0.000000000 0.001785714 0.000000000 0.000000000
#> YAA VAA ARA RRA NRA DRA
#> 0.000000000 0.000000000 0.000000000 0.000000000 0.000000000 0.000000000
#> CRA ERA QRA GRA HRA IRA
#> 0.000000000 0.000000000 0.000000000 0.001785714 0.000000000 0.000000000
#> LRA KRA MRA FRA PRA SRA
#> 0.000000000 0.000000000 0.000000000 0.000000000 0.000000000 0.000000000
Autocorrelation descriptors are defined based on the distribution of amino acid properties along the sequence. The amino acid properties used here are various types of amino acids index (Retrieved from the AAindex database, see Kawashima, Ogata, and Kanehisa (1999), Kawashima and Kanehisa (2000), and Kawashima et al. (2008); see Figure 2 for an illustrated example). Three types of autocorrelation descriptors are defined here and described below.
All the amino acid indices are centralized and standardized before the calculation, i.e.
\[ P_r = \frac{P_r - \bar{P}}{\sigma} \]
where \(\bar{P}\) is the average of the property of the 20 amino acids:
\[ \bar{P} = \frac{\sum_{r=1}^{20} P_r}{20} \quad \textrm{and} \quad \sigma = \sqrt{\frac{1}{2} \sum_{r=1}^{20} (P_r - \bar{P})^2} \]
Figure 2: An illustrated example in the AAIndex database.
For protein sequences, the Moreau-Broto autocorrelation descriptors can be defined as:
\[ AC(d) = \sum_{i=1}^{N-d} P_i P_{i + d} \quad d = 1, 2, \ldots, \textrm{nlag} \]
where \(d\) is called the lag of the autocorrelation; \(P_i\) and \(P_{i+d}\) are the properties of the amino acids at position \(i\) and \(i+d\); \(\textrm{nlag}\) is the maximum value of the lag.
The normalized Moreau-Broto autocorrelation descriptors are defined as:
\[ ATS(d) = \frac{AC(d)}{N-d} \quad d = 1, 2, \ldots, \textrm{nlag} \]
The corresponding function for this descriptor is
extractMoreauBroto(). A typical call would be:
moreau <- extractMoreauBroto(x)
head(moreau, n = 36L)
#> CIDH920105.lag1 CIDH920105.lag2 CIDH920105.lag3 CIDH920105.lag4
#> 0.081573213 -0.016064817 -0.015982990 -0.025739038
#> CIDH920105.lag5 CIDH920105.lag6 CIDH920105.lag7 CIDH920105.lag8
#> 0.079058632 -0.042771564 -0.036320847 0.024087298
#> CIDH920105.lag9 CIDH920105.lag10 CIDH920105.lag11 CIDH920105.lag12
#> -0.005273958 0.052274763 0.082170073 0.005419919
#> CIDH920105.lag13 CIDH920105.lag14 CIDH920105.lag15 CIDH920105.lag16
#> 0.083292042 0.004810584 0.001872446 -0.001531495
#> CIDH920105.lag17 CIDH920105.lag18 CIDH920105.lag19 CIDH920105.lag20
#> -0.011917230 0.071161551 0.033473197 0.026882737
#> CIDH920105.lag21 CIDH920105.lag22 CIDH920105.lag23 CIDH920105.lag24
#> 0.073075402 0.115272790 0.041517897 -0.027025993
#> CIDH920105.lag25 CIDH920105.lag26 CIDH920105.lag27 CIDH920105.lag28
#> 0.033477388 -0.003245255 0.078117010 -0.028177304
#> CIDH920105.lag29 CIDH920105.lag30 BHAR880101.lag1 BHAR880101.lag2
#> 0.046695832 0.020584423 0.052740185 0.030804784
#> BHAR880101.lag3 BHAR880101.lag4 BHAR880101.lag5 BHAR880101.lag6
#> 0.037170476 -0.058993771 0.070641780 -0.089192490
The eight default properties used here are:
Users can change the property names of the AAindex database with the
argument props. The AAindex data shipped with protr can be
loaded by data(AAindex) which has detailed information on
each property. With the arguments customprops and
nlag, users can specify their own properties and lag value
to calculate with. For example:
# Define 3 custom properties
myprops <- data.frame(
AccNo = c("MyProp1", "MyProp2", "MyProp3"),
A = c(0.62, -0.5, 15), R = c(-2.53, 3, 101),
N = c(-0.78, 0.2, 58), D = c(-0.9, 3, 59),
C = c(0.29, -1, 47), E = c(-0.74, 3, 73),
Q = c(-0.85, 0.2, 72), G = c(0.48, 0, 1),
H = c(-0.4, -0.5, 82), I = c(1.38, -1.8, 57),
L = c(1.06, -1.8, 57), K = c(-1.5, 3, 73),
M = c(0.64, -1.3, 75), F = c(1.19, -2.5, 91),
P = c(0.12, 0, 42), S = c(-0.18, 0.3, 31),
T = c(-0.05, -0.4, 45), W = c(0.81, -3.4, 130),
Y = c(0.26, -2.3, 107), V = c(1.08, -1.5, 43)
)
# Use 4 properties in the AAindex database and 3 customized properties
moreau2 <- extractMoreauBroto(
x,
customprops = myprops,
props = c(
"CIDH920105", "BHAR880101",
"CHAM820101", "CHAM820102",
"MyProp1", "MyProp2", "MyProp3"
)
)
head(moreau2, n = 36L)
#> CIDH920105.lag1 CIDH920105.lag2 CIDH920105.lag3 CIDH920105.lag4
#> 0.081573213 -0.016064817 -0.015982990 -0.025739038
#> CIDH920105.lag5 CIDH920105.lag6 CIDH920105.lag7 CIDH920105.lag8
#> 0.079058632 -0.042771564 -0.036320847 0.024087298
#> CIDH920105.lag9 CIDH920105.lag10 CIDH920105.lag11 CIDH920105.lag12
#> -0.005273958 0.052274763 0.082170073 0.005419919
#> CIDH920105.lag13 CIDH920105.lag14 CIDH920105.lag15 CIDH920105.lag16
#> 0.083292042 0.004810584 0.001872446 -0.001531495
#> CIDH920105.lag17 CIDH920105.lag18 CIDH920105.lag19 CIDH920105.lag20
#> -0.011917230 0.071161551 0.033473197 0.026882737
#> CIDH920105.lag21 CIDH920105.lag22 CIDH920105.lag23 CIDH920105.lag24
#> 0.073075402 0.115272790 0.041517897 -0.027025993
#> CIDH920105.lag25 CIDH920105.lag26 CIDH920105.lag27 CIDH920105.lag28
#> 0.033477388 -0.003245255 0.078117010 -0.028177304
#> CIDH920105.lag29 CIDH920105.lag30 BHAR880101.lag1 BHAR880101.lag2
#> 0.046695832 0.020584423 0.052740185 0.030804784
#> BHAR880101.lag3 BHAR880101.lag4 BHAR880101.lag5 BHAR880101.lag6
#> 0.037170476 -0.058993771 0.070641780 -0.089192490
About the standard input format of props and
customprops, see ?extractMoreauBroto for
details.
For protein sequences, the Moran autocorrelation descriptors can be defined as:
\[ I(d) = \frac{\frac{1}{N-d} \sum_{i=1}^{N-d} (P_i - \bar{P}') (P_{i+d} - \bar{P}')}{\frac{1}{N} \sum_{i=1}^{N} (P_i - \bar{P}')^2} \quad d = 1, 2, \ldots, 30 \]
where \(d\), \(P_i\), and \(P_{i+d}\) are defined in the same way as in the first place; \(\bar{P}'\) is the considered property \(P\) along the sequence, i.e.,
\[ \bar{P}' = \frac{\sum_{i=1}^N P_i}{N} \]
\(d\), \(P\), \(P_i\) and \(P_{i+d}\), \(\textrm{nlag}\) have the same meaning as above.
With extractMoran() (which has the identical parameters
as extractMoreauBroto()), we can compute the Moran
autocorrelation descriptors (only print out the first 36 elements):
# Use the 3 custom properties defined before
# and 4 properties in the AAindex database
moran <- extractMoran(
x,
customprops = myprops,
props = c(
"CIDH920105", "BHAR880101",
"CHAM820101", "CHAM820102",
"MyProp1", "MyProp2", "MyProp3"
)
)
head(moran, n = 36L)
#> CIDH920105.lag1 CIDH920105.lag2 CIDH920105.lag3 CIDH920105.lag4
#> 0.062895724 -0.044827681 -0.045065117 -0.055955678
#> CIDH920105.lag5 CIDH920105.lag6 CIDH920105.lag7 CIDH920105.lag8
#> 0.060586377 -0.074128412 -0.067308852 -0.001293384
#> CIDH920105.lag9 CIDH920105.lag10 CIDH920105.lag11 CIDH920105.lag12
#> -0.033747588 0.029392193 0.061789800 -0.023368437
#> CIDH920105.lag13 CIDH920105.lag14 CIDH920105.lag15 CIDH920105.lag16
#> 0.062769417 -0.024912264 -0.028298043 -0.031584063
#> CIDH920105.lag17 CIDH920105.lag18 CIDH920105.lag19 CIDH920105.lag20
#> -0.043466730 0.047830694 0.005883901 -0.001769769
#> CIDH920105.lag21 CIDH920105.lag22 CIDH920105.lag23 CIDH920105.lag24
#> 0.049334048 0.096427969 0.015147594 -0.060092509
#> CIDH920105.lag25 CIDH920105.lag26 CIDH920105.lag27 CIDH920105.lag28
#> 0.007549152 -0.033987885 0.056307675 -0.061844453
#> CIDH920105.lag29 CIDH920105.lag30 BHAR880101.lag1 BHAR880101.lag2
#> 0.021484780 -0.008461776 0.014229951 -0.009142419
#> BHAR880101.lag3 BHAR880101.lag4 BHAR880101.lag5 BHAR880101.lag6
#> -0.003272262 -0.109613332 0.033346233 -0.141538598
Geary autocorrelation descriptors for protein sequences can be defined as:
\[ C(d) = \frac{\frac{1}{2(N-d)} \sum_{i=1}^{N-d} (P_i - P_{i+d})^2}{\frac{1}{N-1} \sum_{i=1}^{N} (P_i - \bar{P}')^2} \quad d = 1, 2, \ldots, 30 \]
where \(d\), \(P\), \(P_i\), \(P_{i+d}\), and \(\textrm{nlag}\) have the same meaning as above.
For each amino acid index, there will be \(3 \times \textrm{nlag}\) autocorrelation
descriptors. The usage of extractGeary() is exactly the
same as extractMoreauBroto() and
extractMoran():
# Use the 3 custom properties defined before
# and 4 properties in the AAindex database
geary <- extractGeary(
x,
customprops = myprops,
props = c(
"CIDH920105", "BHAR880101",
"CHAM820101", "CHAM820102",
"MyProp1", "MyProp2", "MyProp3"
)
)
head(geary, n = 36L)
#> CIDH920105.lag1 CIDH920105.lag2 CIDH920105.lag3 CIDH920105.lag4
#> 0.9361830 1.0442920 1.0452843 1.0563467
#> CIDH920105.lag5 CIDH920105.lag6 CIDH920105.lag7 CIDH920105.lag8
#> 0.9406031 1.0765517 1.0675786 0.9991363
#> CIDH920105.lag9 CIDH920105.lag10 CIDH920105.lag11 CIDH920105.lag12
#> 1.0316555 0.9684585 0.9353130 1.0201990
#> CIDH920105.lag13 CIDH920105.lag14 CIDH920105.lag15 CIDH920105.lag16
#> 0.9340933 1.0207373 1.0251486 1.0290464
#> CIDH920105.lag17 CIDH920105.lag18 CIDH920105.lag19 CIDH920105.lag20
#> 1.0414375 0.9494403 0.9905987 0.9987183
#> CIDH920105.lag21 CIDH920105.lag22 CIDH920105.lag23 CIDH920105.lag24
#> 0.9472542 0.9010009 0.9828848 1.0574098
#> CIDH920105.lag25 CIDH920105.lag26 CIDH920105.lag27 CIDH920105.lag28
#> 0.9897955 1.0290018 0.9400066 1.0584150
#> CIDH920105.lag29 CIDH920105.lag30 BHAR880101.lag1 BHAR880101.lag2
#> 0.9762904 1.0029734 0.9818711 1.0051730
#> BHAR880101.lag3 BHAR880101.lag4 BHAR880101.lag5 BHAR880101.lag6
#> 0.9967069 1.1012905 0.9595859 1.1337056
The CTD descriptors are developed by Dubchak et al. (1995) and Dubchak et al. (1999).
Figure 3: The sequence of a hypothetic protein indicating the
construction of composition, transition, and distribution descriptors of
a protein. The sequence index indicates the position of an amino acid in
the sequence. The index for each type of amino acid in the sequence
(1, 2 or 3) indicates the
position of the first, second, third, … of that type of amino acid. 1/2
transition indicates the position of 12 or 21
pairs in the sequence (1/3 and 2/3 are defined similarly).
Step 1: Sequence Encoding
The amino acids are categorized into three classes according to their attributes, and each amino acid is encoded by one of the indices 1, 2, 3 according to which class it belongs. The attributes used here include hydrophobicity, normalized van der Waals volume, polarity, and polarizability. The corresponding classification for each attribute is listed in Table 1.
| Group 1 | Group 2 | Group 3 | |
|---|---|---|---|
| Hydrophobicity | Polar | Neutral | Hydrophobicity |
| R, K, E, D, Q, N | G, A, S, T, P, H, Y | C, L, V, I, M, F, W | |
| Normalized van der Waals Volume | 0-2.78 | 2.95-4.0 | 4.03-8.08 |
| G, A, S, T, P, D, C | N, V, E, Q, I, L | M, H, K, F, R, Y, W | |
| Polarity | 4.9-6.2 | 8.0-9.2 | 10.4-13.0 |
| L, I, F, W, C, M, V, Y | P, A, T, G, S | H, Q, R, K, N, E, D | |
| Polarizability | 0-1.08 | 0.128-0.186 | 0.219-0.409 |
| G, A, S, D, T | C, P, N, V, E, Q, I, L | K, M, H, F, R, Y, W | |
| Charge | Positive | Neutral | Negative |
| K, R | A, N, C, Q, G, H, I, L, M, F, P, S, T, W, Y, V | D, E | |
| Secondary Structure | Helix | Strand | Coil |
| E, A, L, M, Q, K, R, H | V, I, Y, C, W, F, T | G, N, P, S, D | |
| Solvent Accessibility | Buried | Exposed | Intermediate |
| A, L, F, C, G, I, V, W | R, K, Q, E, N, D | M, S, P, T, H, Y |
For example, for a given sequence MTEITAAMVKELRESTGAGA,
it will be encoded as 32132223311311222222 according to its
hydrophobicity.
Step 2: Compute Composition, Transition, and Distribution Descriptors
Three types of descriptors, Composition (C), Transition (T), and Distribution (D) can be calculated for a given attribute as follows.
Composition is defined as the global percentage for each encoded
class in the protein sequence. In the above example, using the
hydrophobicity classification, the numbers for encoded classes
1, 2, 3 are 5, 10, and 5, so that
the compositions for them will be \(5/20=25\%\), \(10/20=10\%\), and \(5/20=25\%\), where 20 is the length of the
protein sequence. The composition descriptor can be expressed as
\[ C_r = \frac{n_r}{n} \quad r = 1, 2, 3 \]
where \(n_r\) is the number of amino
acid type \(r\) in the encoded
sequence; \(N\) is the length of the
sequence. An example for extractCTDC():
extractCTDC(x)
#> hydrophobicity.Group1 hydrophobicity.Group2 hydrophobicity.Group3
#> 0.29715302 0.40569395 0.29715302
#> normwaalsvolume.Group1 normwaalsvolume.Group2 normwaalsvolume.Group3
#> 0.45195730 0.29715302 0.25088968
#> polarity.Group1 polarity.Group2 polarity.Group3
#> 0.33985765 0.33274021 0.32740214
#> polarizability.Group1 polarizability.Group2 polarizability.Group3
#> 0.33096085 0.41814947 0.25088968
#> charge.Group1 charge.Group2 charge.Group3
#> 0.11032028 0.79003559 0.09964413
#> secondarystruct.Group1 secondarystruct.Group2 secondarystruct.Group3
#> 0.38967972 0.29537367 0.31494662
#> solventaccess.Group1 solventaccess.Group2 solventaccess.Group3
#> 0.43060498 0.29715302 0.27224199
The result shows the elements that are named as
PropertyNumber.GroupNumber in the returned vector.
A transition from class 1 to 2 is the percent frequency with which 1 is followed by 2 or 2 is followed by 1 in the encoded sequences. The transition descriptor can be computed as
\[ T_{rs} = \frac{n_{rs} + n_{sr}}{N - 1} \quad rs = \text{12}, \text{13}, \text{23} \]
where \(n_{rs}\), \(n_{sr}\) are the numbers of dipeptide
encoded as rs and sr in the sequence; \(N\) is the length of the sequence. An
example for extractCTDT():
extractCTDT(x)
#> prop1.Tr1221 prop1.Tr1331 prop1.Tr2332 prop2.Tr1221 prop2.Tr1331 prop2.Tr2332
#> 0.27094474 0.16042781 0.23351159 0.26737968 0.22638146 0.17112299
#> prop3.Tr1221 prop3.Tr1331 prop3.Tr2332 prop4.Tr1221 prop4.Tr1331 prop4.Tr2332
#> 0.21033868 0.20499109 0.23707665 0.27272727 0.15151515 0.24598930
#> prop5.Tr1221 prop5.Tr1331 prop5.Tr2332 prop6.Tr1221 prop6.Tr1331 prop6.Tr2332
#> 0.18181818 0.02139037 0.15686275 0.21925134 0.22816399 0.15864528
#> prop7.Tr1221 prop7.Tr1331 prop7.Tr2332
#> 0.25133690 0.21568627 0.18003565
The distribution descriptor describes the distribution of each attribute in the sequence.
There are five “distribution” descriptors for each attribute, and
they are the position percent in the whole sequence for the first
residue, 25% residues, 50% residues, 75% residues, and 100% residues for
a certain encoded class. For example, there are 10 residues encoded as
2 in the above example, the positions for the first residue
2, the 2nd residue 2 (25% * 10 = 2), the 5th
2 residue (50% * 10 = 5), the 7th 2 (75% * 10
= 7) and the 10th residue 2 (100% * 10) in the encoded
sequence are 2, 5, 15, 17, 20, so that the distribution descriptors for
2 are: 10.0 (2/20 * 100), 25.0 (5/20 * 100), 75.0 (15/20 *
100), 85.0 (17/20 * 100), 100.0 (20/20 * 100).
To compute the distribution descriptor, use
extractCTDD():
extractCTDD(x)
#> prop1.G1.residue0 prop1.G1.residue25 prop1.G1.residue50 prop1.G1.residue75
#> 0.3558719 23.1316726 50.1779359 73.8434164
#> prop1.G1.residue100 prop1.G2.residue0 prop1.G2.residue25 prop1.G2.residue50
#> 99.8220641 0.5338078 27.4021352 47.3309609
#> prop1.G2.residue75 prop1.G2.residue100 prop1.G3.residue0 prop1.G3.residue25
#> 75.2669039 100.0000000 0.1779359 19.5729537
#> prop1.G3.residue50 prop1.G3.residue75 prop1.G3.residue100 prop2.G1.residue0
#> 51.7793594 75.6227758 99.6441281 0.3558719
#> prop2.G1.residue25 prop2.G1.residue50 prop2.G1.residue75 prop2.G1.residue100
#> 25.6227758 48.0427046 75.4448399 100.0000000
#> prop2.G2.residue0 prop2.G2.residue25 prop2.G2.residue50 prop2.G2.residue75
#> 1.4234875 23.3096085 54.4483986 76.3345196
#> prop2.G2.residue100 prop2.G3.residue0 prop2.G3.residue25 prop2.G3.residue50
#> 99.4661922 0.1779359 22.7758007 48.9323843
#> prop2.G3.residue75 prop2.G3.residue100 prop3.G1.residue0 prop3.G1.residue25
#> 69.5729537 99.8220641 0.1779359 20.9964413
#> prop3.G1.residue50 prop3.G1.residue75 prop3.G1.residue100 prop3.G2.residue0
#> 50.8896797 74.5551601 99.6441281 0.5338078
#> prop3.G2.residue25 prop3.G2.residue50 prop3.G2.residue75 prop3.G2.residue100
#> 26.5124555 46.2633452 75.4448399 100.0000000
#> prop3.G3.residue0 prop3.G3.residue25 prop3.G3.residue50 prop3.G3.residue75
#> 0.3558719 24.1992883 50.5338078 73.8434164
#> prop3.G3.residue100 prop4.G1.residue0 prop4.G1.residue25 prop4.G1.residue50
#> 99.8220641 0.3558719 26.5124555 48.3985765
#> prop4.G1.residue75 prop4.G1.residue100 prop4.G2.residue0 prop4.G2.residue25
#> 76.1565836 99.2882562 1.4234875 21.5302491
#> prop4.G2.residue50 prop4.G2.residue75 prop4.G2.residue100 prop4.G3.residue0
#> 51.4234875 75.8007117 100.0000000 0.1779359
#> prop4.G3.residue25 prop4.G3.residue50 prop4.G3.residue75 prop4.G3.residue100
#> 22.7758007 48.9323843 69.5729537 99.8220641
#> prop5.G1.residue0 prop5.G1.residue25 prop5.G1.residue50 prop5.G1.residue75
#> 0.8896797 20.8185053 48.9323843 69.5729537
#> prop5.G1.residue100 prop5.G2.residue0 prop5.G2.residue25 prop5.G2.residue50
#> 99.8220641 0.1779359 24.9110320 49.1103203
#> prop5.G2.residue75 prop5.G2.residue100 prop5.G3.residue0 prop5.G3.residue25
#> 75.2669039 100.0000000 0.3558719 26.1565836
#> prop5.G3.residue50 prop5.G3.residue75 prop5.G3.residue100 prop6.G1.residue0
#> 64.2348754 77.4021352 99.2882562 0.1779359
#> prop6.G1.residue25 prop6.G1.residue50 prop6.G1.residue75 prop6.G1.residue100
#> 22.9537367 50.8896797 74.3772242 99.8220641
#> prop6.G2.residue0 prop6.G2.residue25 prop6.G2.residue50 prop6.G2.residue75
#> 1.6014235 21.5302491 49.2882562 70.8185053
#> prop6.G2.residue100 prop6.G3.residue0 prop6.G3.residue25 prop6.G3.residue50
#> 98.9323843 0.3558719 29.0035587 48.2206406
#> prop6.G3.residue75 prop6.G3.residue100 prop7.G1.residue0 prop7.G1.residue25
#> 77.4021352 100.0000000 0.5338078 23.4875445
#> prop7.G1.residue50 prop7.G1.residue75 prop7.G1.residue100 prop7.G2.residue0
#> 50.0000000 74.5551601 98.9323843 0.3558719
#> prop7.G2.residue25 prop7.G2.residue50 prop7.G2.residue75 prop7.G2.residue100
#> 23.1316726 50.1779359 73.8434164 99.8220641
#> prop7.G3.residue0 prop7.G3.residue25 prop7.G3.residue50 prop7.G3.residue75
#> 0.1779359 27.2241993 48.0427046 75.4448399
#> prop7.G3.residue100
#> 100.0000000
Conjoint triad descriptors are proposed by Shen et al. (2007). The conjoint triad descriptors were used to model protein-protein interactions based on the classification of amino acids. In this approach, each protein sequence is represented by a vector space consisting of descriptors of amino acids. To reduce the dimensions of vector space, the 20 amino acids were clustered into several classes according to their dipoles and volumes of the side chains. The conjoint triad descriptors are calculated as follows:
Step 1: Classification of Amino Acids
Electrostatic and hydrophobic interactions dominate protein-protein interactions. These two kinds of interactions may be reflected by the dipoles and volumes of the side chains of amino acids, respectively. Accordingly, these two parameters were calculated using the density-functional theory method B3LYP/6-31G and the molecular modeling approach. Based on the dipoles and volumes of the side chains, the 20 amino acids can be clustered into seven classes (See Table 2). Amino acids within the same class likely involve synonymous mutations because of their similar characteristics.
| No. | Dipole Scale\(^1\) | Volume Scale\(^2\) | Class |
|---|---|---|---|
| 1 | \(-\) | \(-\) | Ala, Gly, Val |
| 2 | \(-\) | \(+\) | Ile, Leu, Phe, Pro |
| 3 | \(+\) | \(+\) | Tyr, Met, Thr, Ser |
| 4 | \(++\) | \(+\) | His, Asn, Gln, Tpr |
| 5 | \(+++\) | \(+\) | Arg, Lys |
| 6 | \(+'+'+'\) | \(+\) | Asp, Glu |
| 7 | \(+^3\) | \(+\) | Cys |
1 Dipole Scale (Debye): \(-\), Dipole < 1.0; \(+\), 1.0 < Dipole < 2.0; \(++\), 2.0 < Dipole < 3.0; \(+++\), Dipole > 3.0; \(+'+'+'\), Dipole > 3.0 with opposite orientation.
2 Volume Scale (\(\overset{\lower.5em\circ}{\mathrm{A}}\lower.01em^3\)): \(-\), Volume < 50; \(+\), Volume > 50.
3 Cys is separated from class 3 because of its ability to form disulfide bonds.
Step 2: Conjoint Triad Calculation
The conjoint triad descriptors considered the properties of one amino acid and its vicinal amino acids and regarded any three continuous amino acids as a unit. Thus, the triads can be differentiated according to the classes of amino acids, i.e., triads composed of three amino acids belonging to the same classes, such as ART and VKS, can be treated identically. To conveniently represent a protein, we first use a binary space \((\mathbf{V}, \mathbf{F})\) to represent a protein sequence. Here, \(\mathbf{V}\) is the vector space of the sequence features, and each feature \(v_i\) represents a sort of triad type; \(\mathbf{F}\) is the frequency vector corresponding to \(\mathbf{V}\), and the value of the \(i\)-th dimension of \(\mathbf{F} (f_i)\) is the frequency of type \(v_i\) appearing in the protein sequence. For the amino acids that have been categorized into seven classes, the size of \(\mathbf{V}\) should be \(7 \times 7 \times 7\); thus \(i = 1, 2, \ldots, 343\). The detailed description for (\(\mathbf{V}\), \(\mathbf{F}\)) is illustrated in Figure 4.
Figure 4: Schematic diagram for constructing the vector space (\(\mathbf{V}\), \(\mathbf{F}\)) of protein sequences. \(\mathbf{V}\) is the vector space of the sequence features; each feature (\(v_i\)) represents a triad composed of three consecutive amino acids; \(\mathbf{F}\) is the frequency vector corresponding to \(\mathbf{V}\), and the value of the \(i\)-th dimension of \(\mathbf{F} (f_i)\) is the frequency that \(v_i\) triad appeared in the protein sequence.
Clearly, each protein correlates to the length (number of amino acids) of protein. In general, a long protein would have a large value of \(f_i\), which complicates the comparison between two heterogeneous proteins. Thus, we defined a new parameter, \(d_i\), by normalizing \(f_i\) with the following equation:
\[ d_i = \frac{f_i - \min\{\,f_1, f_2 , \ldots, f_{343}\,\}}{\max\{\,f_1, f_2, \ldots, f_{343}\,\}} \]
The numerical value of \(d_i\) of each protein ranges from 0 to 1, enabling the comparison between proteins. Accordingly, we obtain another vector space (designated \(\mathbf{D}\)) consisting of \(d_i\) to represent protein.
To compute conjoint triads of protein sequences, we can use:
ctriad <- extractCTriad(x)
head(ctriad, n = 65L)
#> VS111 VS211 VS311 VS411 VS511 VS611 VS711 VS121 VS221 VS321 VS421 VS521 VS621
#> 0.1 0.3 0.6 0.2 0.4 0.0 0.3 1.0 0.6 0.5 0.0 0.2 0.3
#> VS721 VS131 VS231 VS331 VS431 VS531 VS631 VS731 VS141 VS241 VS341 VS441 VS541
#> 0.0 0.2 0.4 0.5 0.2 0.3 0.3 0.1 0.3 0.3 0.2 0.2 0.0
#> VS641 VS741 VS151 VS251 VS351 VS451 VS551 VS651 VS751 VS161 VS261 VS361 VS461
#> 0.1 0.2 0.2 0.2 0.5 0.1 0.2 0.0 0.0 0.1 0.4 0.2 0.3
#> VS561 VS661 VS761 VS171 VS271 VS371 VS471 VS571 VS671 VS771 VS112 VS212 VS312
#> 0.2 0.0 0.1 0.1 0.3 0.1 0.0 0.1 0.0 0.1 0.8 0.4 0.4
#> VS412 VS512 VS612 VS712 VS122 VS222 VS322 VS422 VS522 VS622 VS722 VS132 VS232
#> 0.6 0.1 0.5 0.2 0.8 0.5 0.2 0.3 0.2 0.0 0.2 0.1 0.3
by which we only outputted the first 65 of 343 dimensions to save space.
The quasi-sequence-order descriptors are proposed by Chou (2000). They are derived from the distance matrix between the 20 amino acids.
The \(d\)-th rank sequence-order-coupling number is defined as:
\[ \tau_d = \sum_{i=1}^{N-d} (d_{i, i+d})^2 \quad d = 1, 2, \ldots, \textrm{maxlag} \]
where \(d_{i, i+d}\) is the distance between the two amino acids at position \(i\) and \(i+d\).
Note: maxlag is the maximum lag and the length of the protein must be not less than \(\textrm{maxlag}\).
The function extractSOCN() is used for computing the
sequence-order-coupling numbers:
extractSOCN(x)
#> Schneider.lag1 Schneider.lag2 Schneider.lag3 Schneider.lag4 Schneider.lag5
#> 204.2036 199.8708 206.8102 197.4828 193.3366
#> Schneider.lag6 Schneider.lag7 Schneider.lag8 Schneider.lag9 Schneider.lag10
#> 208.1936 195.5476 200.9789 196.7110 193.9931
#> Schneider.lag11 Schneider.lag12 Schneider.lag13 Schneider.lag14 Schneider.lag15
#> 199.7031 204.9389 187.0140 198.4702 205.4526
#> Schneider.lag16 Schneider.lag17 Schneider.lag18 Schneider.lag19 Schneider.lag20
#> 193.1274 187.3529 190.4949 202.8853 198.5299
#> Schneider.lag21 Schneider.lag22 Schneider.lag23 Schneider.lag24 Schneider.lag25
#> 191.1013 185.0074 189.9857 202.7113 201.6267
#> Schneider.lag26 Schneider.lag27 Schneider.lag28 Schneider.lag29 Schneider.lag30
#> 194.5770 185.9939 204.1297 191.1629 183.9073
#> Grantham.lag1 Grantham.lag2 Grantham.lag3 Grantham.lag4 Grantham.lag5
#> 6674686.0000 6761609.0000 7138892.0000 6748261.0000 6291229.0000
#> Grantham.lag6 Grantham.lag7 Grantham.lag8 Grantham.lag9 Grantham.lag10
#> 6839853.0000 6594164.0000 6556148.0000 6620183.0000 6770614.0000
#> Grantham.lag11 Grantham.lag12 Grantham.lag13 Grantham.lag14 Grantham.lag15
#> 6495689.0000 6865537.0000 6297267.0000 6498247.0000 6615566.0000
#> Grantham.lag16 Grantham.lag17 Grantham.lag18 Grantham.lag19 Grantham.lag20
#> 6572680.0000 6569081.0000 6173947.0000 6570829.0000 6471308.0000
#> Grantham.lag21 Grantham.lag22 Grantham.lag23 Grantham.lag24 Grantham.lag25
#> 6461649.0000 5939432.0000 6532121.0000 6652472.0000 6480660.0000
#> Grantham.lag26 Grantham.lag27 Grantham.lag28 Grantham.lag29 Grantham.lag30
#> 6382281.0000 6276521.0000 6537634.0000 6442991.0000 6350157.0000
Users can also specify the maximum lag value with the
nlag argument.
Note: Besides the Schneider-Wrede physicochemical
distance matrix (Schneider and Wrede 1994)
used by Kuo-Chen Chou, another chemical distance matrix by Grantham (1974) is also used here. So the
descriptors dimension will be nlag * 2. The
quasi-sequence-order descriptors described next also utilized the two
matrices.
For each amino acid type, a quasi-sequence-order descriptor can be defined as:
\[ X_r = \frac{f_r}{\sum_{r=1}^{20} f_r + w \sum_{d=1}^{\textrm{maxlag}} \tau_d} \quad r = 1, 2, \ldots, 20 \]
where \(f_r\) is the normalized occurrence for amino acid type \(i\) and \(w\) is a weighting factor (\(w=0.1\)). These are the first 20 quasi-sequence-order descriptors. The other 30 quasi-sequence-order are defined as:
\[ X_d = \frac{w \tau_{d-20}}{\sum_{r=1}^{20} f_r + w \sum_{d=1}^{\textrm{maxlag}} \tau_d} \quad d = 21, 22, \ldots, 20 + \textrm{maxlag} \]
Figure 5: A schematic drawing to show (a) the 1st-rank, (b) the 2nd-rank, and (3) the 3rd-rank sequence-order-coupling mode along a protein sequence. (a) Reflects the coupling mode between all the most contiguous residues, (b) that between all the 2nd most contiguous residues, and (c) that between all the 3rd most contiguous residues. This figure is from Chou (2000).
A minimal example for extractQSO():
extractQSO(x)
#> Schneider.Xr.A Schneider.Xr.R Schneider.Xr.N Schneider.Xr.D Schneider.Xr.C
#> 6.096218e-02 6.773576e-02 3.725467e-02 4.910842e-02 6.434897e-02
#> Schneider.Xr.E Schneider.Xr.Q Schneider.Xr.G Schneider.Xr.H Schneider.Xr.I
#> 4.572164e-02 4.572164e-02 7.789612e-02 2.878770e-02 3.386788e-02
#> Schneider.Xr.L Schneider.Xr.K Schneider.Xr.M Schneider.Xr.F Schneider.Xr.P
#> 7.281594e-02 3.725467e-02 1.185376e-02 3.048109e-02 5.080182e-02
#> Schneider.Xr.S Schneider.Xr.T Schneider.Xr.W Schneider.Xr.Y Schneider.Xr.V
#> 8.466970e-02 4.233485e-02 2.201412e-02 4.064145e-02 4.741503e-02
#> Grantham.Xr.A Grantham.Xr.R Grantham.Xr.N Grantham.Xr.D Grantham.Xr.C
#> 1.835033e-06 2.038926e-06 1.121409e-06 1.478221e-06 1.936980e-06
#> Grantham.Xr.E Grantham.Xr.Q Grantham.Xr.G Grantham.Xr.H Grantham.Xr.I
#> 1.376275e-06 1.376275e-06 2.344765e-06 8.665435e-07 1.019463e-06
#> Grantham.Xr.L Grantham.Xr.K Grantham.Xr.M Grantham.Xr.F Grantham.Xr.P
#> 2.191845e-06 1.121409e-06 3.568120e-07 9.175167e-07 1.529194e-06
#> Grantham.Xr.S Grantham.Xr.T Grantham.Xr.W Grantham.Xr.Y Grantham.Xr.V
#> 2.548657e-06 1.274329e-06 6.626509e-07 1.223356e-06 1.427248e-06
#> Schneider.Xd.1 Schneider.Xd.2 Schneider.Xd.3 Schneider.Xd.4 Schneider.Xd.5
#> 3.457972e-02 3.384600e-02 3.502111e-02 3.344162e-02 3.273951e-02
#> Schneider.Xd.6 Schneider.Xd.7 Schneider.Xd.8 Schneider.Xd.9 Schneider.Xd.10
#> 3.525537e-02 3.311390e-02 3.403364e-02 3.331093e-02 3.285068e-02
#> Schneider.Xd.11 Schneider.Xd.12 Schneider.Xd.13 Schneider.Xd.14 Schneider.Xd.15
#> 3.381760e-02 3.470422e-02 3.166883e-02 3.360882e-02 3.479121e-02
#> Schneider.Xd.16 Schneider.Xd.17 Schneider.Xd.18 Schneider.Xd.19 Schneider.Xd.20
#> 3.270408e-02 3.172623e-02 3.225829e-02 3.435647e-02 3.361893e-02
#> Schneider.Xd.21 Schneider.Xd.22 Schneider.Xd.23 Schneider.Xd.24 Schneider.Xd.25
#> 3.236099e-02 3.132904e-02 3.217206e-02 3.432701e-02 3.414334e-02
#> Schneider.Xd.26 Schneider.Xd.27 Schneider.Xd.28 Schneider.Xd.29 Schneider.Xd.30
#> 3.294954e-02 3.149609e-02 3.456720e-02 3.237140e-02 3.114275e-02
#> Grantham.Xd.1 Grantham.Xd.2 Grantham.Xd.3 Grantham.Xd.4 Grantham.Xd.5
#> 3.402298e-02 3.446605e-02 3.638918e-02 3.439801e-02 3.206838e-02
#> Grantham.Xd.6 Grantham.Xd.7 Grantham.Xd.8 Grantham.Xd.9 Grantham.Xd.10
#> 3.486488e-02 3.361253e-02 3.341875e-02 3.374516e-02 3.451195e-02
#> Grantham.Xd.11 Grantham.Xd.12 Grantham.Xd.13 Grantham.Xd.14 Grantham.Xd.15
#> 3.311057e-02 3.499580e-02 3.209915e-02 3.312361e-02 3.372162e-02
#> Grantham.Xd.16 Grantham.Xd.17 Grantham.Xd.18 Grantham.Xd.19 Grantham.Xd.20
#> 3.350302e-02 3.348467e-02 3.147055e-02 3.349358e-02 3.298629e-02
#> Grantham.Xd.21 Grantham.Xd.22 Grantham.Xd.23 Grantham.Xd.24 Grantham.Xd.25
#> 3.293706e-02 3.027516e-02 3.329628e-02 3.390974e-02 3.303396e-02
#> Grantham.Xd.26 Grantham.Xd.27 Grantham.Xd.28 Grantham.Xd.29 Grantham.Xd.30
#> 3.253250e-02 3.199340e-02 3.332438e-02 3.284195e-02 3.236875e-02
where users can also specify the maximum lag with the argument
nlag and the weighting factor with the argument
w.
This group of descriptors is proposed by Chou (2001). PseAAC descriptors are also named as the type 1 pseudo-amino acid composition. Let \(H_1^o (i)\), \(H_2^o (i)\), \(M^o (i)\) (\(i=1, 2, 3, \ldots, 20\)) be the original hydrophobicity values, the original hydrophilicity values and the original side chain masses of the 20 natural amino acids, respectively. They are converted to the following qualities by a standard conversion:
\[ H_1 (i) = \frac{H_1^o (i) - \frac{1}{20} \sum_{i=1}^{20} H_1^o (i)}{\sqrt{\frac{\sum_{i=1}^{20} [H_1^o (i) - \frac{1}{20} \sum_{i=1}^{20} H_1^o (i) ]^2}{20}}} \]
\(H_2^o (i)\) and \(M^o (i)\) are normalized as \(H_2 (i)\) and \(M (i)\) in the same way.
Figure 6: A schematic drawing to show (a) the first-tier, (b) the second-tier, and (3) the third-tier sequence order correlation mode along a protein sequence. Panel (a) reflects the correlation mode between all the most contiguous residues, panel (b) between all the second-most contiguous residues, and panel (c) between all the third-most contiguous residues. This figure is from Chou (2001).
Then, a correlation function can be defined as
\[ \Theta (R_i, R_j) = \frac{1}{3} \bigg\{ [ H_1 (R_i) - H_1 (R_j) ]^2 + [ H_2 (R_i) - H_2 (R_j) ]^2 + [ M (R_i) - M (R_j) ]^2 \bigg\} \]
This correlation function is an average value for the three amino acid properties: hydrophobicity, hydrophilicity, and side chain mass. Therefore, we can extend this definition of correlation functions for one amino acid property or for a set of \(n\) amino acid properties.
For one amino acid property, the correlation can be defined as:
\[ \Theta (R_i, R_j) = [H_1 (R_i) - H_1(R_j)]^2 \]
where \(H (R_i)\) is the amino acid property of amino acid \(R_i\) after standardization.
For a set of n amino acid properties, it can be defined as: where \(H_k (R_i)\) is the \(k\)-th property in the amino acid property set for amino acid \(R_i\).
\[ \Theta (R_i, R_j) = \frac{1}{n} \sum_{k=1}^{n} [H_k (R_i) - H_k (R_j)]^2 \]
where \(H_k(R_i)\) is the \(k\)-th property in the amino acid property set for amino acid \(R_i\).
A set of descriptors named sequence order-correlated factors are defined as:
\[\begin{align*} \theta_1 & = \frac{1}{N-1} \sum_{i=1}^{N-1} \Theta (R_i, R_{i+1})\\ \theta_2 & = \frac{1}{N-2} \sum_{i=1}^{N-2} \Theta (R_i, R_{i+2})\\ \theta_3 & = \frac{1}{N-3} \sum_{i=1}^{N-3} \Theta (R_i, R_{i+3})\\ & \ldots \\ \theta_\lambda & = \frac{1}{N-\lambda} \sum_{i=1}^{N-\lambda} \Theta (R_i, R_{i+\lambda}) \end{align*}\]
\(\lambda\) (\(\lambda < L\)) is a parameter to be specified. Let \(f_i\) be the normalized occurrence frequency of the 20 amino acids in the protein sequence, a set of \(20 + \lambda\) descriptors called the pseudo-amino acid composition for a protein sequence can be defined as:
\[ X_c = \frac{f_c}{\sum_{r=1}^{20} f_r + w \sum_{j=1}^{\lambda} \theta_j} \quad (1 < c < 20) \]
\[ X_c = \frac{w \theta_{c-20}}{\sum_{r=1}^{20} f_r + w \sum_{j=1}^{\lambda} \theta_j} \quad (21 < c < 20 + \lambda) \]
where \(w\) is the weighting factor for the sequence-order effect and is set to \(w = 0.05\) in protr as suggested by Kuo-Chen Chou.
With extractPAAC(), we can compute the PseAAC
descriptors directly:
extractPAAC(x)
#> Xc1.A Xc1.R Xc1.N Xc1.D Xc1.C
#> 9.07025432 10.07806035 5.54293319 7.30659376 9.57415734
#> Xc1.E Xc1.Q Xc1.G Xc1.H Xc1.I
#> 6.80269074 6.80269074 11.58976941 4.28317565 5.03903018
#> Xc1.L Xc1.K Xc1.M Xc1.F Xc1.P
#> 10.83391488 5.54293319 1.76366056 4.53512716 7.55854527
#> Xc1.S Xc1.T Xc1.W Xc1.Y Xc1.V
#> 12.59757544 6.29878772 3.27536961 6.04683621 7.05464225
#> Xc2.lambda.1 Xc2.lambda.2 Xc2.lambda.3 Xc2.lambda.4 Xc2.lambda.5
#> 0.02514092 0.02500357 0.02527773 0.02553159 0.02445265
#> Xc2.lambda.6 Xc2.lambda.7 Xc2.lambda.8 Xc2.lambda.9 Xc2.lambda.10
#> 0.02561910 0.02486131 0.02506656 0.02553952 0.02437663
#> Xc2.lambda.11 Xc2.lambda.12 Xc2.lambda.13 Xc2.lambda.14 Xc2.lambda.15
#> 0.02491262 0.02533803 0.02351915 0.02479912 0.02548431
#> Xc2.lambda.16 Xc2.lambda.17 Xc2.lambda.18 Xc2.lambda.19 Xc2.lambda.20
#> 0.02478210 0.02513770 0.02457224 0.02543046 0.02500889
#> Xc2.lambda.21 Xc2.lambda.22 Xc2.lambda.23 Xc2.lambda.24 Xc2.lambda.25
#> 0.02476967 0.02342389 0.02431684 0.02610300 0.02626722
#> Xc2.lambda.26 Xc2.lambda.27 Xc2.lambda.28 Xc2.lambda.29 Xc2.lambda.30
#> 0.02457082 0.02343049 0.02588823 0.02490463 0.02451951
The extractPAAC() function also provides the additional
arguments props and customprops, which are
similar to those arguments for Moreau-Broto/Moran/Geary autocorrelation
descriptors. For their minor differences, please see
?extracPAAC. Users can specify the lambda parameter and the
weighting factor with the arguments lambda and
w.
Note: In the work of Kuo-Chen Chou, the definition for “normalized occurrence frequency” was not given. In this work, we define it as the occurrence frequency of amino acids in the sequence normalized to 100%, and hence, our calculated values are not the same as their values.
Amphiphilic Pseudo-Amino Acid Composition (APseAAC) was proposed in Chou (2001). APseAAC is also recognized as the type 2 pseudo-amino acid composition. The definitions of these qualities are similar to the PAAC descriptors. From \(H_1 (i)\) and \(H_2 (j)\) defined before, the hydrophobicity and hydrophilicity correlation functions are defined as:
\[\begin{align*} H_{i, j}^1 & = H_1 (i) H_1 (j)\\ H_{i, j}^2 & = H_2 (i) H_2 (j) \end{align*}\]
From these qualities, sequence order factors can be defined as:
\[\begin{align*} \tau_1 & = \frac{1}{N-1} \sum_{i=1}^{N-1} H_{i, i+1}^1\\ \tau_2 & = \frac{1}{N-1} \sum_{i=1}^{N-1} H_{i, i+1}^2\\ \tau_3 & = \frac{1}{N-2} \sum_{i=1}^{N-2} H_{i, i+2}^1\\ \tau_4 & = \frac{1}{N-2} \sum_{i=1}^{N-2} H_{i, i+2}^2\\ & \ldots \\ \tau_{2 \lambda - 1} & = \frac{1}{N-\lambda} \sum_{i=1}^{N-\lambda} H_{i, i+\lambda}^1\\ \tau_{2 \lambda} & = \frac{1}{N-\lambda} \sum_{i=1}^{N-\lambda} H_{i, i+\lambda}^2 \end{align*}\]
Figure 7: A schematic diagram to show (a1/a2) the first-rank, (b1/b2) the second-rank and (c1/c2) the third-rank sequence-order-coupling mode along a protein sequence through a hydrophobicity/hydrophilicity correlation function, where \(H_{i, j}^1\) and \(H_{i, j}^2\) are given by Equation (3). Panel (a1/a2) reflects the coupling mode between all the most contiguous residues, panel (b1/b2) between all the second-most contiguous residues, and panel (c1/c2) between all the third-most contiguous residues. This figure is from Chou (2005).
Then a set of descriptors called Amphiphilic Pseudo-Amino Acid Composition (APseAAC) are defined as:
\[ P_c = \frac{f_c}{\sum_{r=1}^{20} f_r + w \sum_{j=1}^{2 \lambda} \tau_j} \quad (1 < c < 20) \]
\[ P_c = \frac{w \tau_u}{\sum_{r=1}^{20} f_r + w \sum_{j=1}^{2 \lambda} \tau_j} \quad (21 < u < 20 + 2 \lambda) \]
where \(w\) is the weighting factor, its default value is set to \(w = 0.5\) in protr.
A minimal example for extracAPAAC() is:
extractAPAAC(x)
#> Pc1.A Pc1.R Pc1.N
#> 3.537412e+01 3.930458e+01 2.161752e+01
#> Pc1.D Pc1.C Pc1.E
#> 2.849582e+01 3.733935e+01 2.653059e+01
#> Pc1.Q Pc1.G Pc1.H
#> 2.653059e+01 4.520027e+01 1.670445e+01
#> Pc1.I Pc1.L Pc1.K
#> 1.965229e+01 4.225242e+01 2.161752e+01
#> Pc1.M Pc1.F Pc1.P
#> 6.878302e+00 1.768706e+01 2.947844e+01
#> Pc1.S Pc1.T Pc1.W
#> 4.913073e+01 2.456536e+01 1.277399e+01
#> Pc1.Y Pc1.V Pc2.Hydrophobicity.1
#> 2.358275e+01 2.751321e+01 2.196320e-04
#> Pc2.Hydrophilicity.1 Pc2.Hydrophobicity.2 Pc2.Hydrophilicity.2
#> 1.025766e-03 -3.088876e-04 -1.834385e-04
#> Pc2.Hydrophobicity.3 Pc2.Hydrophilicity.3 Pc2.Hydrophobicity.4
#> 1.174146e-03 7.400156e-04 -1.105715e-03
#> Pc2.Hydrophilicity.4 Pc2.Hydrophobicity.5 Pc2.Hydrophilicity.5
#> -4.493680e-04 1.766358e-03 1.471212e-03
#> Pc2.Hydrophobicity.6 Pc2.Hydrophilicity.6 Pc2.Hydrophobicity.7
#> -1.441572e-03 -4.913600e-03 -1.678053e-05
#> Pc2.Hydrophilicity.7 Pc2.Hydrophobicity.8 Pc2.Hydrophilicity.8
#> 7.312356e-04 -1.885399e-03 -1.928708e-03
#> Pc2.Hydrophobicity.9 Pc2.Hydrophilicity.9 Pc2.Hydrophobicity.10
#> -2.931177e-03 -1.555660e-03 2.916597e-03
#> Pc2.Hydrophilicity.10 Pc2.Hydrophobicity.11 Pc2.Hydrophilicity.11
#> 3.602591e-03 1.055082e-04 8.697920e-04
#> Pc2.Hydrophobicity.12 Pc2.Hydrophilicity.12 Pc2.Hydrophobicity.13
#> -9.276413e-04 -2.001384e-03 1.705044e-03
#> Pc2.Hydrophilicity.13 Pc2.Hydrophobicity.14 Pc2.Hydrophilicity.14
#> 4.364007e-03 7.883453e-04 -9.441693e-04
#> Pc2.Hydrophobicity.15 Pc2.Hydrophilicity.15 Pc2.Hydrophobicity.16
#> -3.133437e-04 -3.599332e-03 3.689079e-05
#> Pc2.Hydrophilicity.16 Pc2.Hydrophobicity.17 Pc2.Hydrophilicity.17
#> 2.483867e-03 4.832798e-04 2.465788e-03
#> Pc2.Hydrophobicity.18 Pc2.Hydrophilicity.18 Pc2.Hydrophobicity.19
#> -3.142728e-04 2.021961e-03 6.421283e-05
#> Pc2.Hydrophilicity.19 Pc2.Hydrophobicity.20 Pc2.Hydrophilicity.20
#> -8.896690e-04 -2.986886e-04 9.304039e-04
#> Pc2.Hydrophobicity.21 Pc2.Hydrophilicity.21 Pc2.Hydrophobicity.22
#> -6.777458e-04 1.646818e-03 3.193506e-03
#> Pc2.Hydrophilicity.22 Pc2.Hydrophobicity.23 Pc2.Hydrophilicity.23
#> 3.270656e-03 2.533569e-03 2.478252e-03
#> Pc2.Hydrophobicity.24 Pc2.Hydrophilicity.24 Pc2.Hydrophobicity.25
#> -2.489106e-03 -1.031008e-03 -3.992322e-03
#> Pc2.Hydrophilicity.25 Pc2.Hydrophobicity.26 Pc2.Hydrophilicity.26
#> -2.596060e-03 8.690771e-04 -1.221378e-03
#> Pc2.Hydrophobicity.27 Pc2.Hydrophilicity.27 Pc2.Hydrophobicity.28
#> 5.208649e-03 4.617400e-03 -1.088584e-03
#> Pc2.Hydrophilicity.28 Pc2.Hydrophobicity.29 Pc2.Hydrophilicity.29
#> -2.512263e-03 1.387641e-03 2.060890e-03
#> Pc2.Hydrophobicity.30 Pc2.Hydrophilicity.30
#> 3.177340e-04 1.451909e-03
This function has the same arguments as
extractPAAC().
The profile-based descriptors for protein sequences are available in
the protr package. The feature vectors of profile-based methods were
based on the PSSM by running PSI-BLAST and often show good performance.
See Ye, Wang, and Altschul (2011) and
Rangwala and Karypis (2005) for details.
The functions extractPSSM(), extractPSSMAcc(),
and extractPSSMFeature() are used to generate these
descriptors. Users need to install the NCBI-BLAST+ software package
first to make the functions fully functional.
Proteochemometric (PCM) modeling utilizes statistical modeling to model the ligand-target interaction space. The below descriptors implemented in protr are extensively used in proteochemometric modeling.
Scales-based descriptors derived by Principal Components Analysis
Scales-based descriptors derived by Factor Analysis
Scales-based descriptors derived by Multidimensional Scaling
BLOSUM and PAM matrix-derived descriptors
Note that every scales-based descriptor function can freely combine more than 20 classes of 2D and 3D molecular descriptors to construct highly customized scales-based descriptors. Of course, these functions are designed to be flexible enough that users can provide totally self-defined property matrices to construct scales-based descriptors.
For example, to compute the “topological scales” derived by PCA
(using the first 5 principal components), one can use
extractDescScales():
x <- readFASTA(system.file(
"protseq/P00750.fasta",
package = "protr"
))[[1]]
descscales <- extractDescScales(
x,
propmat = "AATopo",
index = c(37:41, 43:47),
pc = 5, lag = 7, silent = FALSE
)
#> Summary of the first 5 principal components:
#> PC1 PC2 PC3 PC4 PC5
#> Standard deviation 2.581537 1.754133 0.4621854 0.1918666 0.08972087
#> Proportion of Variance 0.666430 0.307700 0.0213600 0.0036800 0.00080000
#> Cumulative Proportion 0.666430 0.974130 0.9954900 0.9991700 0.99998000
The propmat argument invokes the AATopo
dataset shipped with the protr package. The argument index
selects the 37 to 41 and the 43 to 47 columns (molecular descriptors) in
the AATopo dataset to use. The parameter lag
was set for the Auto Cross Covariance (ACC) to generate scales-based
descriptors of the same length. At last, we printed the summary of the
first 5 principal components (standard deviation, proportion of
variance, cumulative proportion of variance).
The result is a length 175 named vector, which is consistent with the descriptors before:
length(descscales)
#> [1] 175
head(descscales, 15)
#> scl1.lag1 scl2.lag1 scl3.lag1 scl4.lag1 scl5.lag1
#> -2.645644e-01 -1.717847e-02 1.975438e-02 -7.930659e-05 -3.710597e-05
#> scl1.lag2 scl2.lag2 scl3.lag2 scl4.lag2 scl5.lag2
#> 3.548612e-01 1.343712e-01 5.699395e-03 -5.489472e-04 -6.364577e-05
#> scl1.lag3 scl2.lag3 scl3.lag3 scl4.lag3 scl5.lag3
#> 2.011431e-02 -9.211136e-02 -1.461755e-03 6.747801e-04 2.386782e-04
For another example, to compute the descriptors derived by the BLOSUM62 matrix and use the first 5 scales, one can use:
x <- readFASTA(system.file(
"protseq/P00750.fasta",
package = "protr"
))[[1]]
blosum <- extractBLOSUM(
x,
submat = "AABLOSUM62",
k = 5, lag = 7, scale = TRUE, silent = FALSE
)
#> Relative importance of all the possible 20 scales:
#> [1] 1.204960e+01 7.982007e+00 6.254364e+00 4.533706e+00 4.326286e+00
#> [6] 3.850579e+00 3.752197e+00 3.538207e+00 3.139155e+00 2.546405e+00
#> [11] 2.373286e+00 1.666259e+00 1.553126e+00 1.263685e+00 1.024699e+00
#> [16] 9.630187e-01 9.225759e-01 7.221636e-01 1.020085e-01 -6.314726e-16
The result is a length 175 named vector:
length(blosum)
#> [1] 175
head(blosum, 15)
#> scl1.lag1 scl2.lag1 scl3.lag1 scl4.lag1 scl5.lag1
#> 0.0042370555 -0.0021502057 0.0005993291 0.0006456375 0.0014849592
#> scl1.lag2 scl2.lag2 scl3.lag2 scl4.lag2 scl5.lag2
#> -0.0014919096 0.0032873726 0.0011734162 -0.0021758536 -0.0018127568
#> scl1.lag3 scl2.lag3 scl3.lag3 scl4.lag3 scl5.lag3
#> -0.0029413528 0.0001494193 0.0003298806 -0.0017877430 -0.0051044133
Dealing with gaps. In proteochemometrics (sequence
alignment), gaps can be very useful since a gap in a certain position
contains information. The protr package has built-in support for such
gaps. We deal with the gaps by using a dummy descriptor to code for the
21st type of amino acid. The function extractScalesGap()
and extractProtFPGap() can be used to deal with such gaps.
See ?extractScalesGap and ?extractProtFPGap
for details.
Similarity computation derived by local or global protein sequence alignment between a list of protein sequences is of great need in protein research. However, this type of pairwise similarity computation is often computationally intensive, especially when many protein sequences exist. Luckily, this process is also highly parallelizable. The protr package integrates the function of parallelized similarity computation derived by local or global protein sequence alignment between a list of protein sequences.
The function twoSeqSim() calculates the alignment result
between two protein sequences. The function parSeqSim()
calculates the pairwise similarity with a list of protein sequences in
parallel:
s1 <- readFASTA(system.file("protseq/P00750.fasta", package = "protr"))[[1]]
s2 <- readFASTA(system.file("protseq/P08218.fasta", package = "protr"))[[1]]
s3 <- readFASTA(system.file("protseq/P10323.fasta", package = "protr"))[[1]]
s4 <- readFASTA(system.file("protseq/P20160.fasta", package = "protr"))[[1]]
s5 <- readFASTA(system.file("protseq/Q9NZP8.fasta", package = "protr"))[[1]]
plist <- list(s1, s2, s3, s4, s5)
psimmat <- parSeqSim(plist, cores = 4, type = "local", submat = "BLOSUM62")
psimmat
## [,1] [,2] [,3] [,4] [,5]
## [1,] 1.00000000 0.11825938 0.10236985 0.04921696 0.03943488
## [2,] 0.11825938 1.00000000 0.18858241 0.12124217 0.06391103
## [3,] 0.10236985 0.18858241 1.00000000 0.05819984 0.06175942
## [4,] 0.04921696 0.12124217 0.05819984 1.00000000 0.05714638
## [5,] 0.03943488 0.06391103 0.06175942 0.05714638 1.00000000
Similarly, the function crossSetSim() calculates the
pairwise similarity between two sets of protein sequences in
parallel.
Note that for a small number of proteins, calculating their pairwise similarity scores derived by sequence alignment in parallel may not significantly reduce the overall computation time since each task only requires a relatively short time to finish. Thus, computational overheads may exist and affect the performance. In our benchmarks, we used about 1,000 protein sequences on 64 CPU cores and observed significant performance improvement compared to the sequential computation.
batches. A useful argument for reducing
memory usage is batches. It splits the similarity
computations into smaller batches. A larger batch number reduces the
memory need for each parallel process but also adds the overhead of
forking new processes. This is a trade-off between time (CPU) and space
(memory). Also, use verbose = TRUE to print the computation
progress.
parSeqSimDisk(). For similarity
computations over an even larger number of protein sequences, please try
parSeqSimDisk() and set batches to a large
number. Unlike the in-memory version, this disk-based function caches
the partial results in each batch to the hard drive and merges all the
results together in the end, which further reduces memory usage.
Example. Let’s assume we have 20,000 sequences. By
setting cores = 64 and batches = 10000 in
parSeqSimDisk(), the workload will be around
20000^2/2/64/10000 = 312.5 alignments per batch per core.
This could give you relatively quick feedback about whether the memory
size is going to be sufficient, and how long the computation will take
in total after the first few batches.
The protr package also integrates the function for similarity score computation derived by Gene Ontology (GO) semantic similarity measures between a list of GO terms or Entrez Gene IDs.
The function twoGOSim() calculates the similarity
derived by GO terms semantic similarity measures between two GO terms /
Entrez Gene IDs, and the function parGOSim() calculates the
pairwise similarity with a list of GO terms / Entrez Gene IDs:
# By GO Terms
go1 <- c(
"GO:0005215", "GO:0005488", "GO:0005515",
"GO:0005625", "GO:0005802", "GO:0005905"
) # AP4B1
go2 <- c(
"GO:0005515", "GO:0005634", "GO:0005681",
"GO:0008380", "GO:0031202"
) # BCAS2
go3 <- c(
"GO:0003735", "GO:0005622", "GO:0005840",
"GO:0006412"
) # PDE4DIP
golist <- list(go1, go2, go3)
parGOSim(golist, type = "go", ont = "CC", measure = "Wang")
## [,1] [,2] [,3]
## [1,] 1.000 0.344 0.17
## [2,] 0.344 1.000 0.24
## [3,] 0.170 0.240 1.00
# By Entrez gene id
genelist <- list(c("150", "151", "152", "1814", "1815", "1816"))
parGOSim(genelist, type = "gene", ont = "BP", measure = "Wang")
## 150 151 152 1814 1815 1816
## 150 1.000 0.702 0.725 0.496 0.570 0.455
## 151 0.702 1.000 0.980 0.456 0.507 0.551
## 152 0.725 0.980 1.000 0.460 0.511 0.538
## 1814 0.496 0.456 0.460 1.000 0.687 0.473
## 1815 0.570 0.507 0.511 0.687 1.000 0.505
## 1816 0.455 0.551 0.538 0.473 0.505 1.000
In this section, we will briefly introduce some useful tools the protr package provides.
This function getUniProt() gets protein sequences from
uniprot.org by protein ID(s). The input ID is a character
vector specifying the protein ID(s). The returned sequences are stored
in a list:
ids <- c("P00750", "P00751", "P00752")
prots <- getUniProt(ids)
prots
## [[1]]
## [1] "MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCN
## SGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECT
## NWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGT
## HSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQ
## YSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVP
## GEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSP
## FYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWG
## LGCGQKDVPGVYTKVTNYLDWIRDNMRP"
##
## [[2]]
## [1] "MGSNLSPQLCLMPFILGLLSGGVTTTPWSLARPQGSCSLEGVEIKGGSFRLLQEGQALEYVCPSGFYPYPVQ
## TRTCRSTGSWSTLKTQDQKTVRKAECRAIHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSANRTCQVNG
## RWSGQTAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDT
## PQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASY
## GVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWNRT
## RHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKD
## MENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKE
## HSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPP
## TTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSP
## YADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL"
##
## [[3]]
## [1] "APPIQSRIIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGRHNLFENENTAQF
## FGVTADFPHPGFNLSLLKXHTKADGKDYSHDLMLLRLQSPAKITDAVKVLELPTQEPELGSTCEASGWGSIEPGPDB
## FEFPDEIQCVQLTLLQNTFCABAHPBKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPS
## IYTKLIFYLDWINDTITENP"
The function readFASTA() provides a convenient way to
read protein sequences stored in FASTA format files. See
?readFASTA for details. The returned sequences are stored
in a named list, whose components are named with the protein sequences’
names.
The Protein Data Bank (PDB) file format is a text file format that
describes the three-dimensional structures of proteins. The
readPDB() function allows you to read protein sequences
stored in PDB format files. See ?readPDB for details.
The protcheck() function checks if the protein
sequence’s amino acid types are in the 20 default types, which returns
TRUE if all the amino acids in the sequence belong to the
20 default types:
x <- readFASTA(system.file("protseq/P00750.fasta", package = "protr"))[[1]]
# A real sequence
protcheck(x)
#> [1] TRUE
# An artificial sequence
protcheck(paste(x, "Z", sep = ""))
#> [1] FALSE
The removeGaps() function allows us to remove/replace
gaps (-) or any “irregular” characters from amino acid
sequences to prepare them for feature extraction or sequence
alignment-based similarity computation.
The protseg() function partitions the protein sequences
to create sliding windows. This is usually required when creating
feature vectors for machine learning tasks. Users can specify a sequence
x, a character aa (one of the 20 amino acid
types), and a positive integer k, which controls the window
size (half of the window).
This function returns a named list. Each component contains one of the segmentations (a character string). Names of the list components are the positions of the specified amino acid in the sequence.
protseg(x, aa = "M", k = 5)
#> $`48`
#> [1] "DEKTQMIYQQH"
#>
#> $`242`
#> [1] "LPWNSMILIGK"
#>
#> $`490`
#> [1] "TVTDNMLCAGD"
#>
#> $`525`
#> [1] "LNDGRMTLVGI"
Auto Cross Covariance (ACC) is extensively used in the scales-based
descriptors computation, this approach calculates the auto covariance
and auto cross covariance for generating scale-based descriptors of the
same length. Users can write their own scales-based descriptor functions
with the help of acc() function in the protr package.
The protr package ships with more than 20 pre-computed 2D and 3D
descriptor sets for the 20 amino acids to use with the scales-based
descriptors. Please use data(package = "protr") to list all
the datasets included in the protr package.
The BLOSUM and PAM matrices for the 20 amino acids can be used to
calculate BLOSUM and PAM matrix-derived descriptors with function
extractBLOSUM(), the datasets are named in
AABLOSUM45, AABLOSUM50,
AABLOSUM62, AABLOSUM80,
AABLOSUM100, AAPAM30, AAPAM40,
AAPAM70, AAPAM120, and
AAPAM250.
As the reference, the AAMetaInfo dataset contains
metadata of the 20 amino acids used for the 2D and 3D descriptor
calculation in the protr package. This dataset includes each amino
acid’s name, one-letter representation, three-letter representation,
SMILE representation, PubChem CID, and PubChem link. See
data(AAMetaInfo) for details.
The web application built on protr, namely ProtrWeb, is available at http://protr.org.
ProtrWeb does not require the user to have any programming knowledge. It is a user-friendly web application that computes the protein sequence descriptors in the protr package.
Figure 8: A screenshot of the web application ProtrWeb.
Source code repository for this Shiny web application: https://github.com/nanxstats/protrweb.
The summary of the descriptors in the protr package is listed in Table 3.
| Descriptor Group | Descriptor Name | Descriptor Dimension | Function Name |
|---|---|---|---|
| Amino Acid Composition | Amino Acid Composition | 20 | extractAAC() |
| Dipeptide Composition | 400 | extractDC() | |
| Tripeptide Composition | 8000 | extractTC() | |
| Autocorrelation | Normalized Moreau-Broto Autocorrelation | 240\(^1\) | extractMoreauBroto() |
| Moran Autocorrelation | 240\(^1\) | extractMoran() | |
| Geary Autocorrelation | 240\(^1\) | extractGeary() | |
| CTD | Composition | 21 | extractCTDC(), extractCTDCClass() |
| Transition | 21 | extractCTDT(), extractCTDTClass() | |
| Distribution | 105 | extractCTDD(), extractCTDDClass() | |
| Conjoint Triad | Conjoint Triad | 343 | extractCTriad(), extractCTriadClass() |
| Quasi-Sequence-Order | Sequence-Order-Coupling Number | 60\(^2\) | extractSOCN() |
| Quasi-Sequence-Order Descriptors | 100\(^2\) | extractQSO() | |
| Pseudo-Amino Acid Composition | Pseudo-Amino Acid Composition | 50\(^3\) | extractPAAC() |
| Amphiphilic Pseudo-Amino Acid Composition | 80\(^4\) | extractAPAAC() |
1 The number depends on the choice of the number of
properties of amino acids and the choice of the maximum values of the
lag. The default is to use 8 types of properties and
lag = 30.
2 The number depends on the maximum value of
lag. By default, lag = 30. Two distance
matrices are used, so the descriptor dimension is \(30 \times 2 = 60\) and \((20 + 30) \times 2 = 100\).
3 The number depends on the choice of the number of the set of amino acid properties and the choice of the \(\lambda\) value. The default is to use 3 types of properties proposed by Kuo-Chen Chou and \(\lambda = 30\).
4 The number depends on the choice of the \(\lambda\) vlaue. The default is \(\lambda = 30\).
The scales-based PCM descriptors in the protr package are listed in Table 4.
| Derived by | Descriptor Class | Function Name | |
|---|---|---|---|
| Principal Components Analysis | Scales-based descriptors derived by Principal Components Analysis | extractScales(), extractScalesGap() | |
| Scales-based descriptors derived by amino acid properties from AAindex (a.k.a. Protein Fingerprint) | extractProtFP(), extractProtFPGap() | ||
| Scales-based descriptors derived by 2D and 3D molecular descriptors (Topological, WHIM, VHSE, etc.) | extractDescScales() | ||
| Factor Analysis | Scales-based descriptors derived by Factor Analysis | extractFAScales() | |
| Multidimensional Scaling | Scales-based descriptors derived by Multidimensional Scaling | extractMDSScales() | |
| Substitution Matrix | BLOSUM and PAM matrix-derived descriptors | extractBLOSUM() |
The amino acid descriptor sets used by scales-based descriptors provided by the protr package are listed in Table 5. Note that the non-informative descriptors (like the descriptors have only one value across all the 20 amino acids) in these datasets have already been filtered out.
| Dataset Name | Descriptor Set Name | Dimensionality | Calculated by |
|---|---|---|---|
| AA2DACOR | 2D Autocorrelations Descriptors | 92 | Dragon |
| AA3DMoRSE | 3D-MoRSE Descriptors | 160 | Dragon |
| AAACF | Atom-Centred Fragments Descriptors | 6 | Dragon |
| AABurden | Burden Eigenvalues Descriptors | 62 | Dragon |
| AAConn | Connectivity Indices Descriptors | 33 | Dragon |
| AAConst | Constitutional Descriptors | 23 | Dragon |
| AAEdgeAdj | Edge Adjacency Indices Descriptors | 97 | Dragon |
| AAEigIdx | Eigenvalue-Based Indices Descriptors | 44 | Dragon |
| AAFGC | Functional Group Counts Descriptors | 5 | Dragon |
| AAGeom | Geometrical Descriptors | 41 | Dragon |
| AAGETAWAY | GETAWAY Descriptors | 194 | Dragon |
| AAInfo | Information Indices Descriptors | 47 | Dragon |
| AAMolProp | Molecular Properties Descriptors | 12 | Dragon |
| AARandic | Randic Molecular Profiles Descriptors | 41 | Dragon |
| AARDF | RDF Descriptors | 82 | Dragon |
| AATopo | Topological Descriptors | 78 | Dragon |
| AATopoChg | Topological Charge Indices Descriptors | 15 | Dragon |
| AAWalk | Walk and Path Counts Descriptors | 40 | Dragon |
| AAWHIM | WHIM Descriptors | 99 | Dragon |
| AACPSA | CPSA Descriptors | 41 | Accelrys Discovery Studio |
| AADescAll | All the 2D Descriptors Calculated by Dragon | 1171 | Dragon |
| AAMOE2D | All the 2D Descriptors Calculated by MOE | 148 | MOE |
| AAMOE3D | All the 3D Descriptors Calculated by MOE | 143 | MOE |
Need mirroring services?
Contact our team at info@vpspulse.com.
Mirror powered by VPSpulse
Infrastructure sponsored by VPSPulse & Secure Payments by ArionPay.